PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016454038.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 443aa    MW: 50600.4 Da    PI: 8.1165
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016454038.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B345.11.8e-141694999
                    HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3  9 dvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                      +k++ l +pk f+ ++ +g +    + ++  + g++W vk+  +     y +++GW eF+++n L+ gD++vF+++g+ ef   v +f++
  XP_016454038.1 16 PGFKHA-LKIPKGFM-KYlKGHE---LEHVVLRRAGKKWLVKV--ND----YQFKTGWGEFAEENVLQLGDMLVFRHEGNVEF--EVIIFDS 94
                    455555.********.6645553...35677889*********..55....559**********************9998777..7777775 PP

2B351.42e-16194273588
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                     +++++ l+ g l+lp +fa++ ++k ++  +l ++de+ rsW+vkl+ + +++r+ +++GW+eF  +n Lk+g+ ++F+++++ 
  XP_016454038.1 194 TIRPYCLTYGYLCLPQQFANSLSNK-KC--DLFIRDERQRSWNVKLS-SDCKNRVSIGDGWREFIADNCLKVGERIMFEVVSDG 273
                     5678999999*********888644.35..7***************5.788889*************************87653 PP

3B362.75.8e-20352431587
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                     ++++++ ++ rl+lp +fa+++g+ +++  +++l+de+ rsW+v+l    ++ ++ +t+GWk+Fvkan++++gD++ F+l+++
  XP_016454038.1 352 TIKPYSINKPRLYLPADFAKSNGLMNRR-CEMILTDEKQRSWSVQL--GLTGHHVAITRGWKKFVKANDVQVGDTFKFELINN 431
                     5688999999************887655.59***************..88888899***********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.108.7E-21497IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.87E-19797IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.943795IPR003340B3 DNA binding domain
CDDcd100171.70E-17893No hitNo description
SMARTSM010191.1E-131095IPR003340B3 DNA binding domain
PfamPF023627.1E-121893IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.5E-18186275IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-16187275IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.3E-9190283IPR003340B3 DNA binding domain
PROSITE profilePS5086311.843190287IPR003340B3 DNA binding domain
PfamPF023622.3E-14194274IPR003340B3 DNA binding domain
CDDcd100174.64E-11203268No hitNo description
Gene3DG3DSA:2.40.330.105.6E-23342439IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.42E-23343440IPR015300DNA-binding pseudobarrel domain
CDDcd100177.90E-20347441No hitNo description
PROSITE profilePS5086314.72348442IPR003340B3 DNA binding domain
SMARTSM010191.5E-19349443IPR003340B3 DNA binding domain
PfamPF023622.7E-18352431IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 443 aa     Download sequence    Send to blast
MKVRPVKPHF FKPIQPGFKH ALKIPKGFMK YLKGHELEHV VLRRAGKKWL VKVNDYQFKT  60
GWGEFAEENV LQLGDMLVFR HEGNVEFEVI IFDSSQCDRE YAEYLQEEEE AATRTFGEIS  120
KNFEFEDTNN YTSIPSGDRL YGSLPSTSCP LSHSRAIDDV IEIPSLNIKS SDEDSSHAEA  180
ATDKHAGHSH FICTIRPYCL TYGYLCLPQQ FANSLSNKKC DLFIRDERQR SWNVKLSSDC  240
KNRVSIGDGW REFIADNCLK VGERIMFEVV SDGKMESIWK FHVVTDAETP KQKFQDLRAN  300
ASLQPEGKKP DLDANRYSAR GLRIETSDMT APKAQVHAST SANNANPHFI STIKPYSINK  360
PRLYLPADFA KSNGLMNRRC EMILTDEKQR SWSVQLGLTG HHVAITRGWK KFVKANDVQV  420
GDTFKFELIN NGTIPIAYFH CKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016454038.10.0PREDICTED: B3 domain-containing protein REM10-like isoform X3
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26680.12e-29B3 family protein